PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G22000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 347aa    MW: 35223.1 Da    PI: 8.8926
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G22000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.36.9e-3896153562
           zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      +l+cprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  ONIVA02G22000.1  96 TLRCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 153
                      679***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3278151IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3197151IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.38597151IPR003851Zinc finger, Dof-type
PROSITE patternPS01361099135IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MVFSSLPIFL DPPNWTQMQQ QPLQCLIGGG GGGGSDHHHL MPPPSGLAPL PSAAGAADTA  60
ASAPAAAAQQ QQPRPAVVSM SERARLARVP LPEPGTLRCP RCDSTNTKFC YFNNYSLSQP  120
RHFCKACRRY WTRGGALRNV PVGGGCRRNT KRSTKKSSSS SSRQGGGAGN AAAAATSSSS  180
TTSTSTTATT SSAAAAAAAA AADVIASMQA GGALLPHHLI GGLPSSAAAA AALEASLEGY  240
HHHHHGHGHQ LPFLQPPPFL QQGLHGYHFA DGDVAAGAAL ADGGFPRGVA SGLLAQLASV  300
KMEEHGTNNG GGFVGAHEQY WHGGNGGGGW PAEFLSGFSS SSSGNVL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2883490.0AK288349.1 Oryza sativa Japonica Group cDNA, clone: J090023P19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619417.11e-138PREDICTED: dof zinc finger protein DOF5.1
TrEMBLA0A0E0G7Z40.0A0A0E0G7Z4_ORYNI; Uncharacterized protein
STRINGLOC_Os12g38200.11e-138(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.15e-39Dof family protein